PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g028740.1
Common NameMTR_7g028740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 368aa    MW: 40921.7 Da    PI: 8.3269
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g028740.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.3e-4176153178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +C v+gC++dls+++eyh+rh+vCe+hsk+pvvlv g++qrfCqqCsrfh+l efD+ krsCr+rL++hn+rrrk+q+
  Medtr7g028740.1  76 ICSVDGCNSDLSDCREYHKRHRVCEKHSKTPVVLVGGKQQRFCQQCSRFHSLAEFDDVKRSCRKRLDGHNKRRRKPQP 153
                      5**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-3370138IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.78774151IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-3975156IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3177150IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MDWDWKEFAW DPSGFDEELK NEGDSMDLRL GDQASDSLEK SVHDSGKEDS KAVSSSLSPS  60
GSLKRSRLQN GSQSMICSVD GCNSDLSDCR EYHKRHRVCE KHSKTPVVLV GGKQQRFCQQ  120
CSRFHSLAEF DDVKRSCRKR LDGHNKRRRK PQPPSLFMAA EKFMYNYKGP RILHFGSPQT  180
YVNPIMRNIW PATSITEAES GYDHQRLLYR IDKHKQDKGH PHWQEILPKS GDVNKAAPGT  240
PISHPIRGAV GSSAGEKGGR KLSSDGKPGS FDSGCALYLL STLQTQSSEL SLMQSSINSP  300
TQSSSGTLHF DATKEYSYSG KVKDKPNGPV FVLDGNTTNL HCNGMLQMGP NGLIENDNSM  360
TLPFFWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-27761501084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133150KRSCRKRLDGHNKRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013447951.10.0squamosa promoter-binding-like protein
TrEMBLA0A072TYQ40.0A0A072TYQ4_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA19G26390.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100312640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-43SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]